PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG031867.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GATA
Protein Properties Length: 187aa    MW: 21460.6 Da    PI: 8.6866
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG031867.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA50.92.2e-16121153133
         GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkk 33 
                  C++C+  kTp+WR gp g+ktLCnaCG++y   
  CCG031867.1 121 CTHCQIDKTPQWRIGPLGPKTLCNACGVRYNTG 153
                  *****************************9765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004013.4E-11115165IPR000679Zinc finger, GATA-type
SuperFamilySSF577169.5E-14118174No hitNo description
Gene3DG3DSA:3.30.50.107.6E-14118152IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS501149.934119150IPR000679Zinc finger, GATA-type
CDDcd002021.16E-13120171No hitNo description
PfamPF003205.0E-14121153IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 187 aa     Download sequence    Send to blast
MVSLFIYALT FFFPASDDVC NVSDDFDWIG SGLSAPKDPI ECVTDFLDGF KSTNELSFLE  60
DFGDFLGKSE EEIETTPSRD FKFGITKKKP RSKRRLKQRA WPTKDCVFSA LENHEFLKRV  120
CTHCQIDKTP QWRIGPLGPK TLCNACGVRY NTGRLFPEYR PAASPSFDQK KHSNLHKLIL  180
RRRANLI
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18796KKPRSKRRLK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011031206.11e-128PREDICTED: GATA transcription factor 7-like
TrEMBLB9H4B51e-114B9H4B5_POPTR; Uncharacterized protein (Fragment)
STRINGPOPTR_0005s06720.11e-114(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1634779
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36240.11e-31GATA transcription factor 7